PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00011.1.g05930.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 687aa    MW: 72904.6 Da    PI: 6.8236
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00011.1.g05930.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.72e-31254309156
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                   k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Zjn_sc00011.1.g05930.1.am.mk 254 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 309
                                   68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.69251311IPR017930Myb domain
SuperFamilySSF466897.17E-17251312IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-28252312IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-26254309IPR006447Myb domain, plants
PfamPF002491.6E-6256307IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MSSSSPSDLT LDYKPNGGAY AAIPKQQQAP PLVDGHHLTT EPASQKLREF LARLEEERLK  60
IDAFKRELPL CMQLLNHAME AYKQQLEAYQ MGSQQAVATR PLVLEEFIPL KNIGIDAVTD  120
KPGNPPSEKA TWMESAQLWN GPAADTAAKG PQTPKERSEH PLPIDTLGTL DGRRSGGGGG  180
AFLPFAKDKS AVPDAATALP ELALAPAEKD AVAEVDRKSP YLDAAGGGNN GVLGALRDTQ  240
NGGASPAPPQ THRKARRCWS PELHRRFVNA LQILGGAQVA TPKQIRELMK VDGLTNDEVK  300
SHLQKYRLHT RRPPAPPNPA TAAPQLVVLG GIWVPPEYAA QGAAPAIYGA HPATQPHYTA  360
AVAAQEYYPS PAAVHHLQHH PATAMLHRAA AAPPPPQAYK AAMAGSPPQS EGRSSAGGGS  420
VGAGGGGSGR ERSESIEEEG EDQEREDDDD DEEQEMNAAK ADAGDEAAGA GAVNSRATAN  480
CNVNCPSQPP CSPTTSAAKE INGDEPKRIG SAVARSNAPP PLCSRELIVV GATCHGLPRN  540
DSCRVVSAIV VYIKAHTDVM PYVSMVMLGS RARRPCSRAS RRAPGTAHRR RPVREEGWYM  600
DARGKTHALR EWAVTLEEDI GLAQGGRRVR AAAAELQDHQ QDGQDAAQEA AAPRVRGVRA  660
AAVHDMSSAN FEVELVSGVN EGAALHR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0865721e-147BT086572.2 Zea mays full-length cDNA clone ZM_BFc0184N23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968400.10.0PREDICTED: probable transcription factor GLK2
TrEMBLK3XH590.0K3XH59_SETIT; Uncharacterized protein
STRINGSi001230m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-65G2-like family protein